PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv_000370_cufa.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family HD-ZIP
Protein Properties Length: 245aa    MW: 28457.7 Da    PI: 4.9387
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv_000370_cufa.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.91.7e-183892256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                       +++++f+++q++ Le+ Fe++ ++  +++ + A++lgL+ rqV +WFqN+Ra++k
  Bv_000370_cufa.t1 38 KNKRRFSDDQVKSLETIFESETKLEPRKKVQVARELGLQPRQVAIWFQNKRARWK 92
                       67789*************************************************9 PP

2HD-ZIP_I/II119.51.8e-3839130293
        HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                        +krr+s++qvk+LE+ Fe+e+kLep++Kv++areLglqprqva+WFqn+RAR+k+kq+Ek+y++Lk++yd+lk++ e ++ke e+L+e+l+e
  Bv_000370_cufa.t1  39 NKRRFSDDQVKSLETIFESETKLEPRKKVQVARELGLQPRQVAIWFQNKRARWKSKQIEKNYRVLKNSYDNLKARLEVIKKERESLQEQLQE 130
                        79***************************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-182494IPR009057Homeodomain-like
SuperFamilySSF466894.71E-182795IPR009057Homeodomain-like
PROSITE profilePS5007117.7673494IPR001356Homeobox domain
SMARTSM003892.0E-163698IPR001356Homeobox domain
PfamPF000467.6E-163892IPR001356Homeobox domain
CDDcd000865.16E-134395No hitNo description
PRINTSPR000312.9E-56574IPR000047Helix-turn-helix motif
PROSITE patternPS0002706992IPR017970Homeobox, conserved site
PRINTSPR000312.9E-57490IPR000047Helix-turn-helix motif
PfamPF021836.1E-1294135IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MMMMQGRETS PEATEADVEV EPLSAEDELP TTRKRKSKNK RRFSDDQVKS LETIFESETK  60
LEPRKKVQVA RELGLQPRQV AIWFQNKRAR WKSKQIEKNY RVLKNSYDNL KARLEVIKKE  120
RESLQEQLQE LRSLLEKSHD RDNGCEDFVD NSQKMSRENG QPDAGLTAKS SDLQEEMDNQ  180
GVLYSDDDRS GTIAYFRQEE SELLKISENI DGSLISPPPV KWCSFDAGTL FDQTSSSSHW  240
WDSWT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13136TRKRKS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010666163.10.0PREDICTED: homeobox-leucine zipper protein ATHB-12-like
TrEMBLA0A0J8B8M10.0A0A0J8B8M1_BETVU; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.21e-36homeobox 7